PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00237.1_g00037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 936aa    MW: 103842 Da    PI: 5.649
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00237.1_g00037.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-173480148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT++Ede l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  Rsa1.0_00237.1_g00037.1 34 KGQWTAQEDEVLCKAVERFQGKNWKKIAECFK-DRTDVQCLHRWQKVL 80
                             799****************************9.************986 PP

2Myb_DNA-binding605.3e-1986132148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+W++eEd+ ++ +v+++G+  W+tI+++++ gR +kqc++rw+++l
  Rsa1.0_00237.1_g00037.1  86 KGPWSKEEDDTIIALVEKYGPTKWSTISQHLP-GRIGKQCRERWHNHL 132
                              79******************************.*************97 PP

3Myb_DNA-binding48.81.6e-15138180145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +++WT+eE++ l++a++ +G++ W+   + ++ gR+++++k++w+
  Rsa1.0_00237.1_g00037.1 138 KNAWTQEEELTLIRAHQIYGNK-WAELTKFLP-GRSDNSIKNHWN 180
                              689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2312980IPR017930Myb domain
SuperFamilySSF466896.17E-183294IPR009057Homeodomain-like
SMARTSM007179.7E-143382IPR001005SANT/Myb domain
PfamPF002497.0E-143480IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-203592IPR009057Homeodomain-like
CDDcd001671.60E-123780No hitNo description
PROSITE profilePS5129432.07181136IPR017930Myb domain
SuperFamilySSF466898.24E-3183179IPR009057Homeodomain-like
SMARTSM007176.1E-1885134IPR001005SANT/Myb domain
PfamPF002497.0E-1886132IPR001005SANT/Myb domain
CDDcd001671.42E-1588132No hitNo description
Gene3DG3DSA:1.10.10.609.8E-2793139IPR009057Homeodomain-like
SMARTSM007179.4E-15137185IPR001005SANT/Myb domain
PROSITE profilePS5129418.31137187IPR017930Myb domain
PfamPF002494.3E-14138181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-21140187IPR009057Homeodomain-like
CDDcd001672.49E-11140180No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MKREMKAPTI PQEGCFQGNN KKGRTCGPAR RSTKGQWTAQ EDEVLCKAVE RFQGKNWKKI  60
AECFKDRTDV QCLHRWQKVL NPELVKGPWS KEEDDTIIAL VEKYGPTKWS TISQHLPGRI  120
GKQCRERWHN HLNPGINKNA WTQEEELTLI RAHQIYGNKW AELTKFLPGR SDNSIKNHWN  180
SSVKKKLDSY YSSGLLDQSQ SSPLITIQNN FIAASSSWMH SSGDEGNFRQ GADAEESECS  240
QASTVFSCSQ STNDILDEVK PANEEFYIPE LPSGTEQQIS NSPSHAESHY PSFEDVKIVV  300
PEISCEAESS KANHNCLTEV RTTTATEDHL QGVSDNARQD CPQLLTNNME GDEKNEACQA  360
FQNSVRLSGQ PSVPNSDTGI QPQPQTLITD EECCRVLFPN TKEDSGVASG EQGQNLVDPQ  420
NGKGSIPASE TKNIPALSWH PSNSNDSVQD CHLLEATAVE HKVDTKDGCI DTSGHVTSHG  480
NDDNDGISEQ QEPSYIPKDL LKLVHLNNFT SPARVNKIHF PIDDKPAEKD KGSLCYEPPR  540
FPSADIPFFS CDLVTSNSDL RQEYSPFGIR QLMISSMNCT TPLRLWDSPC RNKSPDVMLK  600
DAAKSFSGTP SILKKRQHRE LMSPVLDRRK EKLLKSAEAS SLAKDFSRLD VMLNKNECAS  660
SSEARKDTKE TLESGGVTSA NIDQETRRSL VYYNDVEMQI SSPDENGSRP DNKLNTTASE  720
PPFTVDSVPL SAIAGNKTNT AESSFDIIAN CSIFDGTPFK KLLDTPSPWK SPLLFGSFLQ  780
SPKLPPDITF EDIGCFMSPG DRSYDAIGLM KHLSEHTATA YADALEVLGN DTPETILKKR  840
QLNKSIQGKE NQHWHQDQLD NRSQNYTIGR PDYSESSNPP PFAQTKNLGK PFTSQLPVEC  900
RALDFSDCGT PGKAKVSSAS PGGYSSPSSY LLKSCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C9e-66341876159MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-66341876159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599149.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013599148.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013599147.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D3DHD30.0A0A0D3DHD3_BRAOL; Uncharacterized protein
STRINGBra037045.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46742649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein